PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_5.77
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HSF
Protein Properties Length: 204aa    MW: 21897.7 Da    PI: 4.334
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_5.77genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind72.86.3e-23132190260
                                 HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
                HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                                 Fl+k++++++d++l+++isw  +g+sfvv+d+ efa+  Lp+ Fkh+nf+SFvRQLn+Y
  evm.model.supercontig_5.77 132 FLSKTFDLVNDPDLDRIISWGPSGESFVVWDPLEFARFTLPRNFKHNNFSSFVRQLNTY 190
                                 9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF467853.81E-23127190IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.105.7E-25127190IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.7E-19128199IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.6E-12132155IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.3E-19132190IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.6E-12170182IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.6E-12183195IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MNPEEEPASK SPHKSSASAT GTSVKPEMIP PSQPATVSSQ QFPFGSLFVE TAMGFSGSPL  60
SSPFSSPMME FEGLSAVHPQ QSPTSSSHMF EFEAIPVGET AQNLPLSSAE ETASFGVPQP  120
LECLQGNPVP PFLSKTFDLV NDPDLDRIIS WGPSGESFVV WDPLEFARFT LPRNFKHNNF  180
SSFVRQLNTY VGILPVLAGA ICM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5v_D4e-191291902687Heat shock factor protein 1
5d5v_B4e-191291902687Heat shock factor protein 1
5d5u_B4e-191291902687Heat shock factor protein 1
2ldu_A5e-191291901778Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072956.11e-58PREDICTED: heat stress transcription factor A-2c
TrEMBLA0A067KYG22e-58A0A067KYG2_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2290244
Representative plantOGRP9617233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03720.12e-38heat shock transcription factor A3